Total number of results for Phyllomedusa bicolor are 3
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00819 |
SCDTSTCATQRLADFLSRSGGIGSPDFVPTDVSANSF
|
37 | Phyllomedusa bicolor | Calcitonin | Calcitonin gene-related peptide | 10681586#Seon AA, Pierre TN, Redeker V, Lacombe C, Delfour A, Nicolas P, Amiche M#Isolation, structure, synthesis, and activity of a new member of the calcitonin gene-related peptide family from frog skin and molecular cloning of its precursor#J Biol Chem 2000 Feb 25;275(8):5934-40 | |
| NP03932 |
YPPKPESPGEDASPEEMNKYLTALRHYINLVTRQRY
|
36 | Phyllomedusa bicolor | NPY | skin peptide tyrosine-tyrosine | 7937944#Mor A, Chartrel N, Vaudry H, Nicolas P#Skin peptide tyrosine-tyrosine, a member of the pancreatic polypeptide family: isolation, structure, synthesis, and endocrine activity#Proc Natl Acad Sci U S A 1994 Oct 25;91(22):10295-9 | |
| NP05737 |
QNPNRFIGLM
|
10 | Phyllomedusa bicolor | Tachykinin | Phyllomedusin | 5452018#Anastasi A., Erspamer G.F.; #Occurrence of phyllomedusin, a physalaemin-like decapeptide, in the skin of Phyllomedusa bicolor.; #Experientia 26:866-867(1970). |